- Neuromedin UR1/NMUR1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-83433
- 0.1 ml (also 25ul)
- This antibody was developed against Recombinant Protein corresponding to amino acids: TPLCLNCSVL PGDLYPGGAR NPMACNGSAA RGHFDPEDLN LTDEALRLKY LGPQQTELFM P
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Neuromedin UR1/NMUR1
- Human
- (FM-3), FM-3, FM3, GPC-R, GPR66, NMU1R
- neuromedin U receptor 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- GPCR
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
TPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMP
Specifications/Features
Available conjugates: Unconjugated